The Fitness Company Introduce
For those in the Webster, New York area seeking a fitness center that feels different from the typical "big-box" corporate chains, The Fitness Company is a premier choice. This gym has carved out a reputation for being a place where you can get a great workout in a non-corporate, friendly, and well-equipped environment. It's a space designed for serious lifters and casual gym-goers alike, with a wide variety of options to accommodate every fitness goal.
One of the first things members notice is the spacious layout and the extensive range of equipment. As a satisfied customer noted, it's a "great gym to get in and get a good lift." The facility is so well-stocked that you rarely have to wait for popular equipment like squat racks, deadlift bars, or free weight benches. This focus on providing ample resources ensures that your workout is efficient and never interrupted by waiting in line. The gym also offers fresh protein shakes and other single-serve energy drinks at the front desk, providing a convenient and delicious way to refuel after a session.
Beyond the impressive equipment, The Fitness Company is defined by its welcoming atmosphere and dedicated staff. The team is described as "very laid-back and helpful," creating a supportive environment where you can feel at ease. The staff, including specific mentions of Nick and Layla, are praised for being "very attentive and work very hard," showing a genuine commitment to the members' experience. This level of personal attention contributes to the "very non corporate atmosphere" that members love, making it feel more like a community than a business.
Whether you're looking to lift heavy, join a dynamic class, or get a personalized training plan, The Fitness Company has everything you need. It's a place that has exceeded the expectations of many who were looking for a change, proving that a local, community-focused gym can offer superior quality and a more personal touch than larger, more impersonal facilities.
Location and Accessibility
The Fitness Company is conveniently located at 855 Publishers Pkwy, Webster, NY 14580, USA, making it a central and accessible spot for residents in and around Webster. Its location is easy to get to, whether you're coming from work, home, or running errands in the area. The gym is committed to ensuring a welcoming environment for all individuals. It features a wheelchair-accessible entrance, a wheelchair-accessible parking lot, and a wheelchair-accessible restroom. These features demonstrate the gym's dedication to inclusivity and provide a comfortable experience for everyone who walks through its doors.
The gym’s accessibility is a key highlight, as it allows individuals with a wide range of needs to feel welcome and supported. The ease of access from the street to the workout floor means you can focus on your fitness goals without worrying about logistical challenges. The availability of accessible parking right at the entrance simplifies your arrival, and the accessible restrooms ensure a comfortable and seamless experience throughout your visit. This thoughtfulness is a testament to the gym’s focus on the member experience.
Services Offered
- Personal Training and Private Lessons: Work with experienced trainers to create and execute a personalized fitness plan.
- Group Fitness Classes: A wide range of classes including Cycling, Kickboxing, Aerobics, and more.
- Strength and Weight Training: Utilize a comprehensive selection of free weights, machines, and equipment for all levels.
- HIIT Sessions: Engage in High-Intensity Interval Training classes for a challenging and efficient workout.
- Wellness and Nutrition: Receive nutrition consulting and wellness coaching to support your fitness goals.
- Specialized Programs: Offerings include senior fitness programs, obesity weight loss programs, and bodybuilding coaching.
- Variety of Workouts: The gym provides options for Cardio, Treadmill and Elliptical trainer sessions, Functional fitness training, and Core strengthening workouts.
- Flexibility and Mobility: Improve your range of motion with Stretching and Flexibility classes.
Features / Highlights
- Extensive Equipment: The gym is well-stocked with a wide variety of machines, free weights, and cardio equipment, ensuring no waiting time for popular spots.
- Non-Corporate Atmosphere: A laid-back and friendly environment that is a refreshing change from large, intimidating chain gyms.
- Friendly and Attentive Staff: The team is known for being helpful and dedicated to the members, creating a welcoming community.
- Competitive and Fair Pricing: Members find the pricing to be reasonable and fair compared to other gyms in the area.
- Convenient Amenities: The gym offers restrooms and Wi-Fi for a comfortable and connected experience.
- Accessibility: Features a wheelchair-accessible entrance, parking lot, and restroom, making it inclusive for all.
- Multiple Payment Options: Accepts credit cards, debit cards, and NFC mobile payments for convenience.
Contact Information
For more information or to get started with a membership, you can easily contact The Fitness Company. The friendly staff can be reached by phone at (585) 844-5079 or through their mobile number, +1 585-844-5079. If you prefer to visit the location to see the facilities for yourself, the address is 855 Publishers Pkwy, Webster, NY 14580, USA. This direct line of communication makes it simple to inquire about everything from membership plans to class schedules and personal training options.
What is worth choosing
The Fitness Company is a great choice for a number of compelling reasons, as highlighted by its loyal members. The gym's key value proposition lies in its combination of a professional, well-equipped facility and a warm, non-corporate culture. As one member stated, the gym is "very non corporate" with "laid-back and helpful" staff, a stark contrast to some of the larger chains in the area. This personal touch is a major factor in why people choose to make this their fitness home.
The gym also impresses with its practical offerings. One reviewer, who switched from another gym, found that The Fitness Company has "just about everything you’d need/want out of a gym," from a wide variety of free weights and machines to plenty of cardio equipment. The fact that the equipment is rarely out of service is a significant benefit that ensures members can consistently get their workouts in without hassle. Another customer praised the fact that they've "never waited for a squat rack, deadlift bar, press bench, or free weight bench," a rare find in today's fitness landscape.
In addition to the facilities, the fair and competitive pricing makes it an accessible option for many. The staff's genuine attentiveness, specifically mentioned with names like Nick and Layla, shows that the gym's commitment to service goes beyond just the equipment. It’s a place where you're not just a number, but a valued member of a community. The Fitness Company has exceeded expectations for those seeking a change, proving that a local gym with a focus on quality and community can be a far more rewarding experience. It's an excellent choice for anyone in Webster looking to get a serious workout in a supportive and friendly environment.
Alternative Option
The Fitness Company Services
Gym
- Cycling
Energize your routine with our indoor cycling classes, perfect for building endurance and cardiovascular health.
- Kickboxing
Engage in high-energy kickboxing classes designed to improve agility, strength, and calorie burn.
- Nutrition consulting
Receive personalized dietary guidance from expert nutrition consultants to achieve your health and wellness goals.
- Personal training
Tailor your fitness journey with personal training sessions that focus on your specific health and fitness goals.
- Private lessons
Begin or continue your fitness journey with one-on-one instruction, tailored to your individual needs.
- Weight Training
Develop strength and muscle through targeted weight training sessions, suitable for all fitness levels.
- Personal training sessions
Experience customized training that focuses on helping you reach your fitness goals.
- Group fitness classes
Join diverse fitness classes that foster community while helping you work towards your fitness goals.
- Strength training
Build core strength and endurance with our comprehensive strength training programs.
- Weightlifting sessions
Focus on lifting techniques and strength building in our dedicated weightlifting sessions.
- Aerobics classes
Get moving with our high-energy aerobics classes that combine fun, music, and fitness.
- HIIT sessions (High-Intensity Interval Training)
Challenge yourself with high-intensity interval training sessions that alternate conditioning and strength movements to help you build muscle while burning fat.
- Senior fitness programs
Participate in fitness programs specifically designed for seniors, focusing on mobility, strength, and overall health.
- Nutrition counseling
Gain insights into healthy eating habits with our expert nutrition counseling services.
- Wellness coaching
Achieve well-being through holistic wellness coaching that addresses both physical and mental health.
- Bodybuilding coaching
Get specialized coaching in bodybuilding techniques.
- Cardio fitness classes
Boost your heart health and endurance with a variety of cardio-focused fitness classes.
- Treadmill workouts
Utilize our treadmills for guided workouts that improve stamina and heart health.
- Elliptical trainer sessions
Engage in low-impact, high-efficiency elliptical sessions ideal for all fitness levels.
- Functional fitness training
Improve daily living with functional fitness training that enhances strength and balance.
- Core strengthening workouts
Focus on core muscles with workouts designed to enhance stability and prevent injuries.
- Stretching and flexibility classes
Increase your flexibility and reduce injury risk with our guided stretching classes.
- Resistance training
Build muscle and endurance with resistance training sessions using the latest equipment.
- Circuit training
Experience the dynamic challenge of circuit training that boosts strength and stamina by focusing on a wide range of muscle groups.
- Obesity weight loss programs
Join specialized programs aimed at sustainable weight loss.
The Fitness Company Details
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
- Wheelchair accessible restroom
Amenities
- Restroom
- Wi-Fi
Planning
- Membership required
Payments
- Credit cards
- Debit cards
- NFC mobile payments
The Fitness Company Photos
The Fitness Company Location
The Fitness Company
855 Publishers Pkwy, Webster, NY 14580, USA
The Fitness Company Reviews
equipmentmachinesatmospherepersonal trainernameweightscyclingshakesproteinenergy
★ 5★ 4★ 3★ 2★ 1Great gym to get in and get a good lift. Very spacious. I've never waited for a squat rack, deadlift bar, press bench, or free weight bench. It is Well stocked with machines, has great calisthenic and conditioning options, and large rooms for A very non corporate atmosphere and the staff is very laid-back and helpful. There are plenty of classes if interested and the pricing is extremely fair.
July 26 · Zach McDermottI have been going to The Fitness Company in Webster since the beginning of the year. I had previously been a member of a 2 other gyms but chose to come to The Fitness Company for a change. This is a great gym that has just about everything you’d need/want out of a gym. Their pricing is competitive and fair compared to others in the area.Their free weights can accommodate most anybody. Their machine equipment has a wide variety and they rarely have equipment out of service. There is plenty of cardio equipment as well.The gym offers fresh protein shakes at the front desk and they are very good. They also offer single serve energy drinks and protein shakes.The staff are always very friendly and helpful. I’ve personally been impressed by Nick and Layla (unsure of the spelling), they are very attentive and work very hard.After being a member of World Gym in Webster for a long time but being forced to switch gyms due to the closing of World Gym, I am glad I gave The Fitness Company a try. They have exceeded my expectations.
June 12 · Chandler DitchIve always had a soft spot for this gym even back when it was a "golds gym" the name may have changed but the energy i feel from the environment keeps me pushing through my workouts and Todd is just an amazing dude
July 05 · Randy SotoLove this place! My wife and I have gone here for about five years and have loved the safe, clean environment. The staff and trainers are very knowledgeable and the equipment is always functional. If you are considering joining a gym, I highly recommend the Fitness Company!
March 28 · Bug ManI’ve been going to this gym for 50 years with by the way has been owned by the same person, Todd Levine Starting with Great Lakes Gym, then Golds Gym and now The Fitness Company. Always improved equipment, always keeping it clean, always great with his members!!!!!! 👍💪🇺🇸
February 03 · joe profetta
More Fitness Near Me
Burn Boot Camp4.0 (39 reviews)1847 Empire Blvd, Webster, NY 14580, USA
Blue Heron Pilates5.0 (3 reviews)2012 East Ridge Road, Rochester, NY 14622, USA
Planet Fitness4.0 (610 reviews)1850 East Ridge Road, Irondequoit, NY 14622, USA
Body Maintenance4.0 (10 reviews)1720 Culver Rd, Rochester, NY 14609, USA
RRH Fitness & Wellness Center4.0 (82 reviews)100 Kings Hwy S First Floor, Rochester, NY 14617, USA
LA Fitness4.0 (723 reviews)1600 East Ridge Road, Rochester, NY 14621, USA
Positive Force Movement5.0 (5 reviews)Brett Rd, Rochester, NY 14609, USA
Planet Fitness4.0 (378 reviews)1621 Penfield Rd, Penfield, NY 14625, USA
The Five Gym4.0 (65 reviews)1124 1/2, East Ridge Road, Rochester, NY 14617, USA
Great Wolf CrossFit5.0 (56 reviews)1601 Penfield Rd, Rochester, NY 14625, USA
Candace Lee Yoga5.0 (10 reviews)2132 Five Mile Line Rd Suite G, Penfield, NY 14526, USA
Bone Gym5.0 (5 reviews)2200 Penfield Rd, Penfield, NY 14526, USA
Categories
Top Visited Sites
Monticello Gymnastics4.0 (6 reviews)
HealthQuest Fitness & Wellness Center4.0 (250 reviews)
Lauren Trippodo Fitness5.0 (22 reviews)
Strength Center4.0 (8 reviews)
YogaSix Royal Oak4.0 (133 reviews)
24 Hour Fitness3.0 (369 reviews)Must-Read Workout Wisdom Posts
Top Fitness Searches
Trending Workout Wisdom Posts
How to Fit Quality Sessions Into a 3-Run-a-Week Training Plan for Fall Races
How to Incorporate Weight Loss Into Your Day
How to Build Sprint Speed for Short Races Using Strength and Hill Repeats This Fall
Best Warm-Up and Mobility Drills for Hill Repeats and Tempo Runs in Cold Weather
10 Mistakes to Avoid in Your Workout – Improve Performance & Prevent Injuries
How to Incorporate Yoga Into Your Day | Hot Fitness