cocomotion yoga + movement space Introduce
For many New Yorkers, the search for a fitness routine that goes beyond physical exercise is a top priority. In Mt. Sinai, a special place exists where movement and mindfulness intersect: cocomotion yoga + movement space. This is not just a studio; it is a community where people come together to find not only physical strength but also mental clarity and a sense of belonging. The studio’s name itself—cocomotion—hints at its core philosophy: to create motion with and for the community. This article will guide you through the unique offerings and welcoming atmosphere that make this studio a must-visit destination for anyone in the New York area seeking a truly transformative wellness experience.
cocomotion yoga + movement space is a local gem that has cultivated a reputation for its positive and loving environment. As one reviewer eloquently stated, "what I encountered was far from ordinary. Cocomotion is more than just a studio; it's a community with like-minded individuals radiating positive energy, love, and good vibes." This emphasis on community is what truly sets it apart. The instructors are not just teachers; they are guides who bring their own "unique flavor" to each class, making every session a new and enriching experience. Whether you are a beginner or a seasoned practitioner, you are encouraged to push your limits in a supportive and non-judgmental space.
The studio's approach to yoga is holistic, focusing on the connection between body, mind, and spirit. This is a place where you can find your "flow," as another reviewer noted, leading to a "transformation in my range of motion, breath control, and strength." The classes are designed to be dynamic and engaging, helping you find a moving meditation that is both physically challenging and mentally restorative. The studio prides itself on being a space for "real people," where the practice extends "far beyond the mat" into daily life, helping members feel more grounded, centered, and "alive."
cocomotion yoga + movement space is conveniently located at 25 NY-25A, Mt Sinai, NY 11766, USA. This location makes it easily accessible for residents of Mt. Sinai and the surrounding communities on Long Island. Situated on a main road, the studio is simple to find and get to, whether you are driving from home, work, or running errands.
The studio is also highly committed to accessibility for all members of the community. It features a wheelchair accessible entrance, ensuring that individuals with mobility challenges can easily enter and enjoy the space. Additionally, there is a wheelchair accessible parking lot, which adds to the convenience and inclusivity of the location. This focus on making the space welcoming to everyone is a testament to the studio's community-first philosophy.
Services Offered:
Group Lessons: The studio offers a wide variety of group yoga and movement classes, catering to all levels from beginners to advanced practitioners. These sessions are designed to be dynamic and engaging, helping you build strength, flexibility, and a deeper connection to your body.
Private Lessons: For those who prefer a more personalized approach, cocomotion offers one-on-one private lessons. These sessions are tailored to your specific goals and needs, allowing you to receive focused guidance from an expert instructor and accelerate your progress.
Meditation: Beyond physical movement, the studio incorporates meditation into its offerings. These classes and workshops help you find stillness and inner peace, providing a crucial counterbalance to the energetic flow of yoga.
Corporate Yoga & Meditation: The studio provides corporate wellness services, bringing the benefits of yoga and meditation directly to workplaces. This service helps businesses improve employee well-being, reduce stress, and foster a positive work environment.
SUP Yoga: A unique and exciting offering, SUP (Stand Up Paddleboard) Yoga takes the practice to the water. This outdoor service provides a new challenge for balance and core strength while allowing you to enjoy the serenity of nature.
Educational Wellness: cocomotion goes beyond standard classes by hosting monthly workshops on a range of wellness topics, such as breathwork, Reiki, and sound baths. These events offer a deeper dive into holistic health and personal growth.
Features and Highlights:
Online and Onsite Services: The studio offers both in-person and online classes, providing flexibility for New Yorkers with varying schedules. As one reviewer mentioned, the online classes are "easy to follow (virtually)," making it possible to practice from the comfort of your home.
Outdoor Services: With offerings like SUP Yoga, the studio embraces the beauty of the outdoors, providing a unique and refreshing way to practice.
Wheelchair Accessibility: The studio is dedicated to inclusivity, featuring a wheelchair accessible entrance and a wheelchair accessible parking lot.
Restroom: A clean and accessible restroom is available for all clients, ensuring a comfortable experience.
Flexible Payments: The studio accepts a variety of payment methods, including credit cards, debit cards, and NFC mobile payments, making transactions convenient and easy.
Exceptional Community and Instructors: As highlighted by reviews, the studio is praised for its "positive energy, love, and good vibes" and for the "invaluable wisdom" gained from its community and instructors. This is a place where you feel welcomed and supported on your journey.
Contact Information:
Address: 25 NY-25A, Mt Sinai, NY 11766, USA
Phone: (631) 831-0579
What is worth choosing cocomotion yoga + movement space? For residents of New York seeking a yoga studio that offers more than just a workout, cocomotion is a clear choice. The studio's commitment to building a strong, positive, and supportive community is a significant differentiator. This is a place where you are not just a client; you are a valued member of a family. The diverse range of services, from traditional yoga classes to unique offerings like SUP Yoga and specialized workshops, ensures that your practice will never be stagnant. The studio provides opportunities for continuous growth and exploration, both on and off the mat.
The convenience of having online, onsite, and outdoor classes makes it incredibly easy to fit yoga into your busy life. The dedication to accessibility, from the entrance to the parking lot, reflects the studio's inclusive ethos. As the review from a long-time member attests, the guidance provided by the instructors leads to a tangible "transformation" in one's practice and well-being. Choosing cocomotion is an investment in your holistic health—a chance to not only strengthen your body but also to calm your mind and nourish your spirit in a loving community.
cocomotion yoga + movement space Services
Yoga Studio
- Group lessons
- Private lessons
- Yoga Classes
- Meditation
- Corporate Yoga & Meditation
- SUP Yoga
- Educational Wellness
cocomotion yoga + movement space Details
Service options
- Online classes
- Outdoor services
- Onsite services
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
Amenities
- Restroom
Payments
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
cocomotion yoga + movement space Photos
cocomotion yoga + movement space Location
cocomotion yoga + movement space
25 NY-25A, Mt Sinai, NY 11766, USA
cocomotion yoga + movement space Reviews
communityfeelmindclasssweatwalkingpracticebodyteensmusic
★ 5★ 4★ 3★ 2★ 1My journey into the world of yoga began this year. With my first class at Cocomotion, I anticipated a standard yoga session, similar to those I had experienced at other studios. However, what I encountered was far from ordinary. Cocomotion is more than just a studio; it's a community with like-minded individuals radiating positive energy, love, and good vibes. Each instructor brings their unique flavor to the class, and I've grown to love them all. When I step into Cocomotion, I'm enveloped in a sense of tranquility, and I've gained invaluable wisdom from this extraordinary community. Their monthly workshops as: breathwork, Reiki, and sound baths, are exceptional. Without a doubt, I would definitely recommend Cocomotion to anyone seeking a transformative yoga experience.
November 08 · Carmelina ChecoBeen attending Coco's classes regularly for a few years now. Amazed by how he has guided a transformation in my range of motion, breath control, and strength. Endless variations on similar themes allows for a weekly focus on the new, while keeping it easy to follow (virtually). Sincerely thankful for this centering influence and flow. Payment for online classes is based on a "what you can" model. Highly recommended!
September 12 · Edward RashbaCoco is a phenomenal yoga instructor and extremely patient with new members. My first time trying out yoga was at his studio and I left feeling more encouraged than ever. His classes are super fast paced, but not to the point where beginners can't keep up. It was the most movement I've done in a while. Wish I didn't go and buy an elliptical before trying out one of Coco's classes because now I'm about ready to return it ;) Amazing vibes, I'll definitely be back!
February 01 · Chelsea SinclairFantastic little studio! I visited as a drop-in and was warmly welcomed to their space by Coco & the other teachers. The class I attended as a flow and 1.5 hours long, but it was extremely well taught! Many of the poses and moves were things I'd not done before or not in that particular sequence which was a very welcomed change, and each movement was eased into with clear instruction and guidance!Truly a great experience and excited to go back when I visit home again.
December 23 · Nick AndrianasI didn’t know what I was looking for, but when I walked into Cocomotion I found it! Amazing community of yogis! I started with Jane’s beginner class and quickly grew to love the challenge of every class. Depending on what you need that day, there is a class for that. All the instructors bring their own unique “Amazing “ to the mat. Tribal dance will help you shake the day off and leave you feeling blissful! Great variety of workshops offered monthly. Kirtan is offered weekly and not to be missed. The community Open Mike nights are Fantastic! You will never leave disappointed! I am so thankful to have found this community.
September 11 · maxmmgt
More Fitness Near Me
Arsens Gym | 24/7 Stratford, Ct4.0 (34 reviews)300 Long Beach Blvd, Stratford, CT 06615, USA
Fitness Court at Seaside Park5.0 (4 reviews)5Q4V+QF, Bridgeport, CT 06604, USA
Veres Fitness Center4.0 (5 reviews)Veres St, Fairfield, CT 06824, USA
Boost Sports Performance Academy5.0 (20 reviews)210 Old Dam Rd, Fairfield, CT 06824, USA
Fit Club Strength & Conditioning5.0 (80 reviews)210 Old Dam Rd, Fairfield, CT 06824, USA
HeadSpace Wellness and Fitness5.0 (2 reviews)1188 Wells Pl, Stratford, CT 06615, USA
Powerhouse Gym Bridgeport4.0 (159 reviews)99 Beardsley Ave, Stratford, CT 06615, USA
Black Rock Pilates Studio4.0 (17 reviews)2889 Fairfield Ave 2nd floor, Bridgeport, CT 06605, USA
Hellbent Barbell4.0 (9 reviews)955 Connecticut Ave, Bridgeport, CT 06607, USA
Bend Yoga and Wellness5.0 (27 reviews)245 Naugatuck Ave, Milford, CT 06460, USA
My Gym Children's Fitness Center Fairfield4.0 (35 reviews)1139 Post Rd, Fairfield, CT 06824, USA
Ortiz Boxing Gym, Inc.4.0 (21 reviews)955 Connecticut Ave Suite 1311, Bridgeport, CT 06607, USA
Categories
Top Visited Sites
StretchLab5.0 (309 reviews)
CrossFit Federal Way4.0 (45 reviews)
Hardcore Fitness Winter Park4.0 (205 reviews)
San Dimas Dance & Yoga5.0 (4 reviews)
Ltd Academy4.0 (12 reviews)
Anytime Fitness4.0 (49 reviews)Must-Read Workout Wisdom Posts
Top Fitness Searches
Trending Workout Wisdom Posts
How to Do Workout Safely and Effectively | Fitness Tips and Strategies
How to Use Smartwatch Training Status to Time Hard Sessions and Recovery Days in Fall 2025 – Expert Tips from Hot Fitness
Science-Backed Tips for Improving Your Training – Expert Fitness Advice
The Best Strength and Conditioning Drills to Improve Reaction Time and Agility for Fall Sports
How to Stay Motivated in Your Pilates Journey – Expert Tips for 2025
Plant-Based Athlete Nutrition: Powering Your Fall Workouts Without Animal Products