Yoga Factory Annapolis Introduce
For those living in or around Maryland, the search for a truly impactful wellness practice often leads to yoga. But with so many options, finding a studio that offers variety, expert instruction, and a welcoming atmosphere can be a challenge. That's where Yoga Factory Annapolis comes in. This studio is a beacon for those seeking a dynamic and supportive environment to deepen their practice, whether they are a complete beginner or a seasoned yogi. It stands out by offering a diverse range of classes, particularly specializing in hot yoga styles, which are known for their detoxifying and muscle-releasing benefits. The commitment to providing excellent instruction and a variety of class formats ensures that every student can find a path that is right for their body and their goals, making it a valuable addition to the local wellness community.
Yoga Factory Annapolis is not just a place to practice; it's a hub of positive energy and personal growth. The studio's mission is to provide a space where individuals can feel empowered, challenged, and supported. The instructors are a key part of this experience, consistently praised by clients for their expertise and ability to create a great class. The variety of classes means that you can explore different styles of yoga, from the meditative and restorative Yin to the more vigorous and intense Bikram and Vinyasa. This flexibility allows members to customize their wellness journey, keeping their routine fresh and engaging. The sense of community is strong, and the supportive environment motivates people to show up consistently and try new things. For anyone in Maryland looking to invest in their health, this studio offers a comprehensive and rewarding experience that is truly worth the investment.
Located in a convenient and accessible part of Annapolis, Yoga Factory is easy to get to for residents throughout the area. You can find the studio at 1901 West St, Annapolis, MD 21401, USA. Its prime location on West Street makes it a practical choice for those with busy schedules. The studio also prioritizes accessibility, offering a wheelchair-accessible entrance, a wheelchair-accessible parking lot, and a wheelchair-accessible restroom. These features ensure that the studio is welcoming and accommodating to everyone in the community, reflecting a commitment to inclusivity that is core to the practice of yoga. Finding a spot with such thoughtful amenities allows people to focus on their practice without any added stress.
The services at Yoga Factory Annapolis are designed to be comprehensive, offering a wide array of classes to suit different needs, preferences, and fitness levels. The studio's schedule is packed with a variety of offerings, ensuring you'll always find a class that fits your day and your mood. The core services include:
- A Variety of Hot Yoga Classes: The studio specializes in hot yoga, with popular styles like Bikram and Hot Vinyasa. These classes are practiced in a heated room, which helps to warm up muscles, increase flexibility, and promote a deep sweat, which can aid in detoxification.
- Yin Yoga: For those seeking a slower-paced, more meditative practice, the Yin Yoga class is an excellent choice. This class focuses on holding poses for longer periods to target the body's deep connective tissues, providing relief from joint and back pain. As one customer noted, the class is designed for what you can comfortably manage and helps you feel better and move better afterward.
- Vinyasa Yoga: Known as "flow" yoga, Vinyasa classes link breath to movement in a continuous sequence of poses. These classes are great for building strength, increasing endurance, and improving flexibility. The studio offers Vinyasa classes of various lengths and intensities.
- Strength Training and HIIT Classes: Beyond traditional yoga, the studio also offers classes that incorporate strength training and high-intensity interval training (HIIT). This variety allows members to cross-train and add more dynamic workouts to their routine.
- Monthly Memberships: The studio offers monthly membership options, which are highly recommended by customers. A membership motivates you to attend classes consistently and try new things, making your wellness investment even more valuable.
Yoga Factory Annapolis has a number of features that make it a standout destination for yoga and wellness in the Maryland area. These highlights contribute to the studio's excellent reputation and the positive experiences of its members.
- Excellent Instructors: The studio is home to a team of excellent instructors who are knowledgeable and supportive. Customers praise them for their ability to guide all levels of students through the practice, providing a great experience no matter your skill level. The instructors are a key reason why the studio is "absolutely love" by its members.
- Wide Variety of Classes: With over 100 classes offered weekly across its locations, Yoga Factory provides an unparalleled variety of class types. This means you can easily find a class that suits your mood, from intense, sweaty workouts to restorative, calming sessions.
- Welcoming and Supportive Environment: The studio's atmosphere is known for being positive and encouraging. It's a place where you can feel comfortable and motivated to try new things and challenge yourself.
- Accessibility for All: The commitment to accessibility, including a wheelchair-accessible entrance, parking lot, and restroom, makes the studio a welcoming place for a wider range of the community.
- Flexible Payment Options: The studio accepts credit cards and debit cards, making it easy to pay for classes or memberships.
To learn more about the classes or to start your wellness journey, you can easily get in touch with Yoga Factory Annapolis. The staff is ready to answer your questions and help you find the right class for your needs.
Address: 1901 West St, Annapolis, MD 21401, USA
Phone: (410) 533-1908 or +1 410-533-1908
There are many reasons why Yoga Factory Annapolis is worth choosing for Maryland residents. First and foremost is the incredible variety of classes. Unlike studios that focus on a single style, Yoga Factory offers everything from invigorating Bikram to gentle Yin, ensuring that you can find a class that meets your body's needs on any given day. This variety is a major motivator, as it keeps your routine fresh and prevents boredom, which can often derail a fitness journey. The quality of the instructors is another critical factor. Customers consistently highlight the expertise and professionalism of the teachers, like Bria, who makes a class comfortable and effective, even for those with chronic pain. This level of personalized care and knowledge is an invaluable part of the experience. Furthermore, the studio's commitment to creating a welcoming and supportive environment makes it an ideal place for everyone. A monthly membership is a great investment because it provides a framework for consistent practice and encourages you to explore the full range of what the studio has to offer. For anyone in Maryland looking for a comprehensive, high-quality yoga studio that combines variety, expert instruction, and a positive community, Yoga Factory Annapolis is an excellent choice that will help you feel better and achieve your wellness goals.
Yoga Factory Annapolis Details
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
- Wheelchair accessible restroom
Amenities
- Restroom
Payments
- Credit cards
- Debit cards
- Credit cards
Yoga Factory Annapolis Photos





Yoga Factory Annapolis Location
Yoga Factory Annapolis
1901 West St, Annapolis, MD 21401, USA
Yoga Factory Annapolis Reviews
classesbikramstudentscommunityroomsvinyasapracticenameeveningself awareness
★ 5★ 4★ 3★ 2★ 1Visited today for the first time. I did yin yoga with Bria. She's great, and I feel so much better. I have a lot of joint and back pain and the class is designed to be only what you can comfortably manage. I'm definitely moving better after class. I'll be coming back as soon as I can!
May 24 · James EAbsolutely love the yoga factory- I love the variety of classes offered and all of the instructors are excellent... Definitely worth the investment! I highly recommend signing up for the monthly membership as it motivates you to try new things and show up consistently.
May 07 · Megan MarlerClose community, great instructors. As a new student, they remember your name and make you feel welcome. Recommend even if just visiting. 29$ for 10 classes is unbeatable beginner deal
May 25 · Luca BielendaI am Van. I have been do yoga at Yoga Factory in Annapolis 5 years. I love Phil, Katy and all the yoga teachers. I believe when you come here to practice yoga, you will feel the friendliness of everyone here.
September 21 · vân anh trầnAbsolutely love this yoga studio! The atmosphere is calming and inviting, making it easy to unwind. The instructors are very welcoming, kind and supportive. They provide clear guidance and are always available to help with any questions. I leave each class feeling at peace, grounded, and strong. Highly recommend for anyone, especially beginners!
September 20 · Rose Pratt
More Fitness Near Me
Annapolis Power Yoga4.0 (13 reviews)1901 West St, Annapolis, MD 21401, USA
Fitness Together5.0 (32 reviews)111 Chinquapin Round Rd Ste 201, Annapolis, MD 21401, USA
Annapolis Boxing5.0 (45 reviews)111 Chinquapin Round Rd Suite 114, Annapolis, MD 21401, USA
12 Labours CrossFit Annapolis5.0 (61 reviews)1789 McGuckian St, Annapolis, MD 21401, USA
Evolutions by Coppermine4.0 (93 reviews)1834 George Ave, Annapolis, MD 21401, USA
RISE Fitness & Kickboxing4.0 (126 reviews)1927 Lincoln Dr, Annapolis, MD 21401, USA
OJEI Gym Equipment Repair5.0 (8 reviews)17 Carver St, Annapolis, MD 21401, USA
Prana Studio4.0 (20 reviews)2049 West St, Annapolis, MD 21401, USA
Chesapeake Pilates Center5.0 (8 reviews)108 Old Solomons Island Rd #9u, Annapolis, MD 21401, USA
Life Time3.0 (52 reviews)200 Harker Pl, Annapolis, MD 21401, USA
Snap Fitness Annapolis4.0 (43 reviews)2101 Somerville Rd Suite 120, Annapolis, MD 21401, USA
F45 Training Annapolis Harbour4.0 (43 reviews)2580 Solomons Island Rd, Annapolis, MD 21401, USA
Categories
Top Visited Sites
Gotham Gymnastics4.0 (88 reviews)
Planet Fitness4.0 (414 reviews)
CrossFit Wingman - Gym4.0 (151 reviews)
Club Pilates4.0 (150 reviews)
LA Fitness3.0 (492 reviews)
Skye High Gymnastics Center4.0 (19 reviews)Must-Read Workout Wisdom Posts
Top Fitness Searches
Trending Workout Wisdom Posts
How to Incorporate Weight Loss Into Your Day – Practical Tips for Success
How to Do Pilates Safely and Effectively: A Complete Guide
Beginner’s Guide to Pilates: Getting Started with Pilates Workouts
How to Periodize Your Strength and Running Work for Consistent Off-Season Progress
Best Foods to Eat Before and After Cardio - Boost Your Performance
How to Stay Motivated in Your Strength Training Journey
