Be One Yoga Studio Introduce
For residents of Washington, particularly in the Kirkland and Redmond area, finding a yoga studio that is both a place of practice and a true sanctuary for personal wellness is a significant find. Be One Yoga Studio stands out as a unique destination, offering much more than just a typical yoga class. It is a holistic wellness center where you can find balance, strength, and inner peace in a supportive community. This article will provide a comprehensive overview of what makes Be One Yoga Studio a premier choice for locals, from its diverse class offerings, including the area's only aerial workshops, to its commitment to creating a welcoming and professional environment for all practitioners.
The core identity of Be One Yoga Studio is built on a foundation of professional instruction, a welcoming atmosphere, and a variety of unique experiences. The studio is praised by its members for its "amazing" instructors who are "encouraging, patient, and always supportive." This positive environment is particularly important for newcomers, as one reviewer shared their experience trying aerial yoga for the first time. Despite being "very intimidated," they were immediately put at ease by the "kind" instructor, Deandra, who made the "whole class... so much fun." This highlights the studio's commitment to making every person feel comfortable, regardless of their fitness level or past experience.
Another key highlight is the exclusivity of their services. A satisfied customer noted that Be One is the "only studio in the area that offers aerial" yoga, which provides a truly "unique experience." This positions the studio as a go-to destination for those looking for something different from traditional yoga. The studio's emphasis on a quality heat experience in its hot yoga classes is also a strong point, with the well-maintained facilities and professional flooring contributing to an overall positive and therapeutic practice. The community-oriented approach, including free community classes and a judgment-free atmosphere, ensures that Be One Yoga Studio is not just a business, but a vital part of the local wellness scene.
Be One Yoga Studio is conveniently located at 11220 NE 124th St, Kirkland, WA 98034, USA. Its central location makes it easily accessible for residents of Kirkland and the surrounding communities. The studio is committed to accessibility, featuring a wheelchair accessible entrance, a wheelchair accessible parking lot, and a wheelchair accessible restroom. This ensures that everyone can comfortably and safely access the facilities. Additionally, the studio offers free parking in both a parking garage and a parking lot, providing a hassle-free experience for members. The easy-to-find location and ample, free parking make it simple to attend classes and workshops without worrying about logistics.
Be One Yoga Studio offers a comprehensive suite of wellness services, extending beyond traditional yoga to include massage and spa treatments.
Yoga Classes: The studio offers a wide range of yoga classes, including hot yoga, hot vinyasa, and aerial yoga. Classes are designed to cater to various skill levels, from beginners to advanced practitioners, and are led by a team of professional and compassionate instructors.
Workshops and Specialized Programs: The studio is well-known for its unique workshops, such as aerial workshops and sound bath sessions. These specialized events allow members to explore different aspects of wellness and deepen their practice.
Yoga Teacher Training: Be One Yoga Studio is dedicated to fostering the next generation of yoga instructors by offering teacher training programs. These programs are designed to provide aspiring teachers with the knowledge and skills they need to sequence and teach safely and effectively.
Facial Spa Services: Beyond yoga, the studio also functions as a facial spa, offering a range of treatments to help clients with skin care and rejuvenation. This service provides a holistic approach to beauty and wellness.
Massage Therapy: The studio is also a home to a massage therapist, offering professional massage services to help with muscle recovery, relaxation, and overall well-being. This is a great complement to a regular yoga practice.
The features and highlights of Be One Yoga Studio are centered on providing an exceptional and inclusive experience for every person who walks through its doors.
Unique Aerial Yoga: As the only studio in the area offering aerial yoga, Be One provides a distinct and popular service that attracts students looking for a fun and new way to practice.
Expert and Compassionate Instructors: The teaching staff is consistently praised for their professionalism, knowledge, and ability to create a supportive and encouraging environment for all students.
Holistic Wellness Offerings: The combination of yoga, massage therapy, and facial spa services provides a comprehensive approach to self-care, allowing members to address multiple wellness needs in one convenient location.
Active Military Discounts: The studio offers discounts for active military personnel, demonstrating a commitment to supporting the community.
Accessibility and Convenience: The studio's wheelchair accessible features and free, ample parking ensure that the facility is accessible and convenient for a wide range of community members.
Flexible Payment Options: The studio accepts credit cards, debit cards, and NFC mobile payments, making it easy to pay for classes, workshops, and services.
For all your inquiries and to learn more about class schedules and appointments, you can contact Be One Yoga Studio directly.
Address: 11220 NE 124th St, Kirkland, WA 98034, USA
Phone: (425) 820-9642
What makes Be One Yoga Studio worth choosing is its unique blend of specialized services, professional instruction, and a deeply welcoming atmosphere. It’s a place where you can find a unique fitness experience like aerial yoga, receive professional teacher training, and enjoy additional wellness services like massage and facials, all under one roof. The positive feedback from local users, who highlight the unique aerial classes, supportive instructors, and kind atmosphere, serves as a strong testament to the studio's quality. For any Washington resident looking for a yoga studio that goes beyond the ordinary—providing a sanctuary for growth, a place for healing, and a community for connection—Be One Yoga Studio in Kirkland is an excellent choice. It’s a place where you can truly "be one" with your mind, body, and spirit.
Alternative Option
Be One Yoga Studio Services
Yoga Studio
- Teachers Training
- Teaching Training
Be One Yoga Studio Details
Service options
- Online classes
- Onsite services
Highlights
- Active military discounts
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
- Wheelchair accessible restroom
Amenities
- Restroom
- Wi-Fi
- Wi-Fi
- Swimming pool
Planning
- Appointment required
Payments
- Credit cards
- Debit cards
- NFC mobile payments
Parking
- Free parking garage
- Free parking lot
Be One Yoga Studio Photos










Be One Yoga Studio Location
Be One Yoga Studio
11220 NE 124th St, Kirkland, WA 98034, USA
Be One Yoga Studio Reviews
classhathahot yogatowelsenergypracticefeellavenderheatcommunity
★ 5★ 4★ 3★ 2★ 1I’ve been attending the aerial workshop in Kirkland for a while, and I absolutely love it! The instructors are amazing—encouraging, patient, and always supportive. It’s such a unique experience, especially since this is the only studio in the area that offers aerial.
September 24 · tanushree ChowdhuryI tried aerial yoga for the first time because a friend recommended it may help with my back pain. I was very intimidated because I hadn't worked out in a while and wasn't sure if I would be able to last the whole class with my back issues. Deandra was very kind and immediately made me feel at ease and the whole class was so much fun!
August 09 · Lahela SchoesslerI went for the Feb Aerial Sound Bath with Adam and it was a transcendental experience.If looking to add to or up your Self Love/Self Care routine I highly recommend signing up for a session.I've also done a yoga Nidra/sound bath session with Adam elsewhere, so looking forward to attending a session with him at Be One in the near future.
February 06 · Regena WilliamsFirst visit, on the first day of brand new ownership! This yoga studio is so awesome! The space is huge and beautiful, professional flooring unlike any other yoga studio I’ve ever practiced in, quality heat, good vibes, great instruction.Tracy, the brand new owner taught an awesome class and although I was just passing through town, I could tell there were tons of cool events and energy around the studio. I met other students, other teachers who were practicing in class. Great community.
September 01 · Brandon SommersI would say I am a mid-level in in terms of yoga experience, and I have been to quite a few studios. I’m going to say this is the best yoga studio I’ve ever been to. It’s a very welcoming space, nice lobby area, a generous bathroom with two showers (for women’s not sure about men’s), and a decent sized room that’s a good hot temp that gets you going but not dying.All the instructors so far have been great, and my favorite is Steve. He leads the free class on Saturdays at noon. Seriously, the best kept secret in Kirkland!My absolute favorite part about the studio is that they give you a cold lavender towel at the end of class, as you relax into your final Shavasana.Lastly, I feel like the people that come here are pretty chill. I would say there’s a lot more diversity at this studio than I’ve seen at others, in terms of background, age, as well as skill level/experience.The only sort of annoying thing is their website / sign up - sometimes it’s clunky or doesn’t work for me. When that happens I just show up and the staff are always lovely and accommodating. I’ve never been turned away!Okay that’s all this place rocks!
January 13 · Kristin E
More Fitness Near Me
StretchLab4.0 (174 reviews)11316 NE 124th St, Kirkland, WA 98034, USA
[solidcore] Totem Lake4.0 (24 reviews)12670 120th Ave NE Suite 182, Kirkland, WA 98034, USA
LA Fitness3.0 (1078 reviews)12321 120th Pl NE, Kirkland, WA 98034, USA
The Gymnastics Connection4.0 (37 reviews)11611 NE 116th St, Kirkland, WA 98033, USA
DOP STRENGTH GYM4.0 (21 reviews)11831 124th Ave NE, Kirkland, WA 98034, USA
Lake Washington CrossFit5.0 (44 reviews)11853 124th Ave NE, Kirkland, WA 98034, USA
Orion Sports Club5.0 (66 reviews)12015 124th Ave NE, Kirkland, WA 98034, USA
Orion Boxing Gym0.0 (0 reviews)12015 124th Ave NE Gym A, Kirkland, WA 98034, USA
La Luna Rhythmic Gymnastics Academy4.0 (29 reviews)11251 120th Ave NE, Kirkland, WA 98033, USA
KidZone Kirkland at LaLuna Gymnastics Academy0.0 (0 reviews)11251 120th Ave NE, Kirkland, WA 98033, USA
O2 PILATES STUDIO0.0 (0 reviews)11232 120th Ave NE STE 109, Kirkland, WA 98033, USA
Jazzercise5.0 (6 reviews)13027 100th Ave NE, Kirkland, WA 98034, USA
Categories
Top Visited Sites
EXRT Performance5.0 (3 reviews)
Heaverlo House Fitness5.0 (5 reviews)
Kinetic Kids Gymnastics4.0 (38 reviews)
CrossFit Petoskey5.0 (39 reviews)
Fiore Pilates5.0 (7 reviews)
Joy of Moving: Dance Exercise, Pilates, Stretch & Tone, Senior Fitness0.0 (0 reviews)Must-Read Workout Wisdom Posts
Top Fitness Searches
Trending Workout Wisdom Posts
How to Pick the Right Running Club for Community, Coaching and Consistency | Expert Tips
The Best Beginner-Friendly Strength Programs for Real Results in 12 Weeks
Best Apps to Track Your Home Workout Progress for Consistent Results
Why Yoga Is the Secret to Your Success
Best Foods to Eat Before and After Gym: Boost Your Workout Performance
How to Stay Motivated in Your Bodyweight Training | Tips for Consistency
