Hot Fitness
Hot FitnessWorkout WisdomFitness Near Me
ArizonaCaliforniaConnecticutDelawareDistrict of ColumbiaFloridaGeorgiaIllinoisIndianaIowaKansasKentuckyMaineMarylandMassachusettsMichiganMissouriNebraskaNevadaNew HampshireNew JerseyNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandTennesseeVermontVirginiaWashingtonWest VirginiaWisconsin

Hot FitnessFitness Near MeMarylandAnne Arundel CountyAnnapolisFitness in College ParkwayTrue Moon Yoga and Fitness
True Moon Yoga and Fitness ico

True Moon Yoga and Fitness
- 530 College Pkwy, Annapolis, MD 21409

Yoga studio ★5.0

530 College Pkwy, Annapolis, MD 21409, USA

5.0
True Moon is my absolute favorite! I started here about a year and a half ago after finding out it was down the street from me, and I couldn't be more grateful to be a part of this community.I've grown so much in my practice - they have all the best classes (I personally love Hot Vinyasa and their HIIT Sculpt class). I've made coming here a part of my routine, and I always feel so welcomed.The best part about True Moon is the community. I've made friends with multiple instructors, and now get to come to a space where I laugh, sweat, and have the best time! The owner, Emily, and all of the instructors (I'm partial to classes with Joy and Kate) are so kind and helpful.Do yourself a favor and join True Moon!! 🌙 - Delia Burl
True Moon Yoga and Fitness Overview Intro Services Detail Photos Location Reviews

True Moon Yoga and Fitness Introduce

Welcome to True Moon Yoga and Fitness, your local destination for holistic well-being located in Annapolis, Maryland. More than just a studio, True Moon is a vibrant community built on a foundation of authentic connection and personal growth. We believe that movement, whether through the flow of yoga or the power of high-intensity training, is a path to a more balanced and fulfilling life. Our studio is a sanctuary where you can sweat, laugh, and find a sense of belonging among like-minded individuals. We pride ourselves on being a women-owned business dedicated to creating a safe, supportive, and inclusive environment for everyone.

What truly sets True Moon apart is the incredible sense of community that our owner, Emily, and all of the instructors have cultivated. It’s a place where you don't have to fit a certain mold to be accepted, and where you're encouraged to face insecurities and try something new. Our members consistently rave about the welcoming atmosphere, noting that they have made friends and feel like they are part of a family. This supportive environment is a key reason why so many people are able to stick with their fitness goals and see real progress in their practice.

At True Moon, we offer a diverse range of classes to cater to every mood and fitness goal. Whether you are looking for the meditative flow of a Hot Vinyasa class or the invigorating challenge of a HIIT Sculpt session, you will find something to love here. As one member shared, they have grown so much in their practice and personally love the Hot Vinyasa and HIIT Sculpt classes. The variety keeps workouts fresh and engaging, and our experienced instructors are skilled at guiding you through each session, ensuring you are challenged while also practicing safely.

We understand that taking the first step can be daunting. But as one client shared, they were so glad they took the leap and tried out True Moon. The team, especially Emily, is incredibly helpful and welcoming, making the transition into our community a smooth and positive experience. Our instructors, like Joy and Kate, are praised for their kindness and ability to help clients feel comfortable and supported. We are committed to meeting you where you are in your fitness journey and helping you advance in a safe way.

Our mission is to unify people by cultivating authentic community through movement. We believe that by sharing our stories and finding strength in community, we can inspire each other to grow. This philosophy extends beyond our in-studio classes to our various offerings, including private lessons, outdoor sessions, and even fitness retreats. We want to be a part of your journey, whether that journey is on the mat, online, or in a new and exciting location.

We are proud to be an eco-friendly studio, making conscious choices that align with our values. Our radiant heat panels are not only therapeutic for your practice but also energy-efficient. We don’t sell plastic water bottles and we email receipts instead of printing them, keeping our focus on what matters most—delivering a great yoga and fitness experience while being kind to our planet. This dedication to our values is just another reason why so many people are happy to call True Moon their fitness home.

In every class, you will be guided to connect with your body and your breath. We provide a space for you to challenge yourself physically, quiet your mind, and feel a sense of accomplishment. Our wide variety of classes and offerings ensures that you can tailor your program to meet your specific needs and continue to grow in your practice. We truly believe that our community is unparalleled, and we invite you to join us and discover why our members feel so grateful to be a part of the True Moon family.

---

True Moon Yoga and Fitness is conveniently located at 530 College Pkwy, Annapolis, MD 21409, USA. Our studio is situated to be easily accessible for residents of Annapolis and the surrounding areas. We are committed to accessibility, offering a wheelchair accessible entrance, a wheelchair accessible parking lot, and a wheelchair accessible restroom to ensure that all members of our community can visit us with comfort and ease. We have plenty of free parking available, making your visit seamless from start to finish.

---

At True Moon Yoga and Fitness, we offer a wide range of services to cater to every individual’s wellness journey.

  • Group Lessons: We provide a full schedule of in-person and online group classes, with a variety of formats including Vinyasa Yoga, Traditional Hot Yoga, and our signature HIIT Sculpt classes. These classes are perfect for anyone looking to sweat, challenge themselves, and connect with others.

  • Private Lessons: For those seeking personalized attention, we offer one-on-one sessions with our expert instructors to help you deepen your practice, work toward specific goals, or address individual needs.

  • HIIT Classes: Our high-intensity interval training classes, including HIIT Sculpt, are designed to build strength, improve cardiovascular fitness, and tone your body using light weights, bands, and bodyweight exercises.

  • Massage Therapy: We offer massage services to help you recover, release tension, and enhance your overall well-being, providing a holistic approach to your fitness and health.

  • Teacher Training: For those who want to deepen their knowledge and become an instructor, we offer comprehensive teacher training programs in multiple yoga styles, as well as our proprietary classes.

  • Fitness Retreats: We organize both local and international fitness retreats, providing an opportunity to immerse yourself in your practice, relax, and connect with the community in a beautiful new setting.

  • Group Parties: We host private group parties and events, offering a fun and unique way to celebrate special occasions with your friends, family, or coworkers.

  • Vinyasa Yoga: Our Vinyasa classes are dynamic sequences of poses that synchronize breath with movement, helping you to find a flow that matches your energy, gain strength and flexibility, and calm your mind.

  • Traditional Hot Yoga: Based on a classic 26-posture sequence, this class is designed to strengthen and tone your body while helping you improve your focus and concentration.

---

True Moon Yoga and Fitness is distinguished by a variety of key features that enhance the member experience.

  • Women-Owned: We are proud to be a women-owned business, dedicated to creating a welcoming and inclusive space for all.

  • Community Focus: We prioritize building an authentic community where members and staff support one another, creating a positive and motivating environment.

  • Online & Outdoor Services: We offer both online classes and outdoor services, providing flexibility and convenience for your practice no matter where you are.

  • Kid-Friendly: Our services are good for kids, with specialized classes and a welcoming environment for younger members.

  • Wheelchair accessible: Our facility is fully wheelchair accessible, with an accessible entrance, parking lot, and restroom, ensuring that our studio is open to everyone.

  • NFC mobile payments: We accept a variety of payment options, including credit cards, debit cards, and NFC mobile payments, making your transactions seamless and convenient.

---

For more information, to book a class, or to speak with a member of our team, you can contact True Moon Yoga and Fitness directly.

  • Address: 530 College Pkwy, Annapolis, MD 21409, USA

  • Phone: (443) 534-0971

---

When it comes to choosing a yoga or fitness studio in the Maryland area, True Moon Yoga and Fitness offers a truly unique and compelling value that makes it a top choice for so many.

The most significant reason to choose True Moon is the unparalleled community atmosphere. As our members have consistently shared, this studio feels like a family. The support and genuine connection you’ll find here are what make it special. This isn’t a place where you just go to work out; it’s a place where you go to connect, grow, and feel supported by everyone around you. This sense of belonging is a powerful motivator that will keep you coming back.

Furthermore, the variety of services and classes we offer is exceptional. From traditional yoga flows to high-intensity fitness classes, we provide a holistic approach to wellness that caters to your every need. You can find a class that helps you relax and restore, or one that pushes you to your physical limits. This versatility ensures that your routine never gets boring and you can continually challenge yourself in new ways. Our commitment to offering private lessons, retreats, and teacher training also means that we can support you at every stage of your wellness journey.

Finally, the quality of our instruction and our commitment to being an inclusive, women-owned business sets us apart. Our instructors are not just teachers; they are kind, helpful, and passionate guides who are dedicated to your success. The focus on making our studio eco-friendly and accessible to all demonstrates our commitment to our values and our community. In short, True Moon Yoga and Fitness is more than a studio; it is a supportive community that provides a high-quality, comprehensive, and meaningful path to wellness.

True Moon Yoga and Fitness Services

  • Yoga Studio

  • Group lessons
  • Private lessons
  • Massage
  • HIIT Classes

    High Intensity Interval Training This all-in-one workout intense interval training with static yoga postures

  • Teacher Training

    When: March 6th - June 6th Where: True Moon Yoga Cost: $2799 Our aim is to empower practitioners and future teachers! In our Yoga Alliance 200-hr YTT you will dive into advancing your practice, building confidence, and discovering your voice.

  • Fitness Retreats
  • Group Parties
  • Vinyasa Yoga

    Vinyasa Yoga...a dynamic sequence of poses. This practice involves synchronizing the breath with a continuous flow of postures.

  • Moon Flow Affirmations

    Moon Flow Affirmations This practice gets right to the point. Opening with Affirmations, Sun Salutation, and Lunges. Then flowing through conditioning poses stacked one after the other. This is a strong, sweaty, and fun practice.

  • Traditional Hot Yoga

    Traditional Hot Yoga 26 Postures + Music 26 postures and 2 breathing exercises, focuses on 100% of the human body, working from the inside out.

True Moon Yoga and Fitness Details

  • From the business

  • Identifies as women-owned
  • Service options

  • Online classes
  • Outdoor services
  • Onsite services
  • Accessibility

  • Wheelchair accessible entrance
  • Wheelchair accessible parking lot
  • Wheelchair accessible restroom
  • Amenities

  • Restroom
  • Planning

  • Appointment required
  • Payments

  • Credit cards
  • Debit cards
  • NFC mobile payments
  • Credit cards
  • Children

  • Good for kids

True Moon Yoga and Fitness Photos

True Moon Yoga and Fitness Picture 1True Moon Yoga and Fitness Picture 2True Moon Yoga and Fitness Picture 3True Moon Yoga and Fitness Picture 4True Moon Yoga and Fitness Picture 5True Moon Yoga and Fitness Picture 6True Moon Yoga and Fitness Picture 7True Moon Yoga and Fitness Picture 8True Moon Yoga and Fitness Picture 9True Moon Yoga and Fitness Picture 10

True Moon Yoga and Fitness Location

True Moon Yoga and Fitness

530 College Pkwy, Annapolis, MD 21409, USA

True Moon Yoga and Fitness Reviews

An average rating of ★5 from 38 user reviews.

classescommunityHIITschedulespacevinyasamatterfeltpeacefulpressure

★ 5★ 4★ 3★ 2★ 1

More Fitness Near Me

  • Yoga Factory ArnoldYoga Factory Arnold5.0 (1 reviews)

    1460 Ritchie Hwy Suite 205, Arnold, MD 21012, USA

  • Barre Forward - Barre Studio in Annapolis/Severna Park areaBarre Forward - Barre Studio in Annapolis/Severna Park area5.0 (122 reviews)

    1460 Ritchie Hwy #108, Arnold, MD 21012, USA

  • Anytime FitnessAnytime Fitness4.0 (82 reviews)

    1550 Whitehall Rd, Annapolis, MD 21409, USA

  • Jenkins GymnasiumJenkins Gymnasium4.0 (11 reviews)

    101 College Parkway, Ring Road, Arnold, MD 21012, USA

  • Yoga TSWYoga TSW5.0 (5 reviews)

    Severn Commerce Center, 1244 Ritchie Hwy STE 13, Arnold, MD 21012, USA

  • Thrive Gym - ArnoldThrive Gym - Arnold4.0 (30 reviews)

    1244 Ritchie Hwy, Arnold, MD 21012, USA

  • The Greater Annapolis Y in ArnoldThe Greater Annapolis Y in Arnold4.0 (564 reviews)

    1209 Ritchie Hwy, Arnold, MD 21012, USA

  • Third DeckThird Deck5.0 (2 reviews)

    94-98 Bowyer Rd, Naval Academy, MD 21402, USA

  • Excel Pilates Annapolis, Inc.Excel Pilates Annapolis, Inc.5.0 (35 reviews)

    11 Annapolis St suite a, Annapolis, MD 21401, USA

  • MacDonough HallMacDonough Hall3.0 (9 reviews)

    Holloway Rd, Naval Academy, MD 21402, USA

  • Ridgely RetreatRidgely Retreat4.0 (23 reviews)

    203 Ridgely Ave, Annapolis, MD 21401, USA

  • Iglehart GymIglehart Gym4.0 (8 reviews)

    King George St, Annapolis, MD 21401, USA

  • Categories

    Top Visited Sites

    Must-Read Workout Wisdom Posts

    Top Fitness Searches

    Trending Workout Wisdom Posts