Hot Fitness
Hot FitnessWorkout WisdomFitness Near Me
ArizonaCaliforniaConnecticutDelawareDistrict of ColumbiaFloridaGeorgiaIllinoisIndianaIowaKansasKentuckyMaineMarylandMassachusettsMichiganMissouriNebraskaNevadaNew HampshireNew JerseyNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandTennesseeVermontVirginiaWashingtonWest VirginiaWisconsin

Hot FitnessFitness Near MeRhode IslandProvidence CountySmithfieldFitness in Douglas PikeSmithfield Fitness

Smithfield Fitness
- 970 Douglas Pike, Smithfield, RI 02917

Gym, Boot camp ★3.0

970 Douglas Pike, Smithfield, RI 02917, USA

3.0
The only way is gym is still in business is from robbing people and if you sign up, you’re a fool after reading these reviews I canceled my membership. the woman that runs it is a nasty person. My card was charged multiple times after cancellation. I had my bank change the information and somehow they found out my information again. This is all with the fraud department with my bank. Then they comment back saying sorry we can’t find you in our Information to make it seem like you weren’t a member. The only people that are responding positively are the owners or friends. - Joe 2112
Smithfield Fitness Overview Intro Services Detail Photos Location Reviews

Smithfield Fitness Introduce

Introduction / Overview

Are you a resident of Rhode Island looking for a fitness center that feels like home? Look no further than Smithfield Fitness. This local gem isn't just a place with weights and treadmills; it's a community-oriented gym designed to help you achieve your health and wellness goals. At Smithfield Fitness, the focus is on providing a supportive and encouraging atmosphere where everyone, regardless of their fitness level, can feel comfortable and motivated. It’s a place where you can find innovative equipment, knowledgeable staff, and a wide array of programs tailored to your unique needs. Whether you’re a seasoned athlete or just starting your journey, Smithfield Fitness is dedicated to inspiring, informing, and entertaining you on your path to a healthier life.


Location and Accessibility

Smithfield Fitness is conveniently located at 970 Douglas Pike, Smithfield, RI 02917, USA. Its prime location makes it easily accessible for residents across Smithfield and surrounding communities in Rhode Island. The facility prioritizes accessibility for all members, offering a wheelchair accessible entrance, wheelchair accessible parking lot, and a wheelchair accessible restroom. These features ensure that the gym is a welcoming and inclusive space for everyone. Finding the gym is a breeze, whether you’re driving from a nearby town or commuting from within Smithfield. Its position on a major roadway also provides a straightforward route, making your trip to the gym quick and hassle-free.


Services Offered

Smithfield Fitness is more than just a place to lift weights; it offers a comprehensive suite of services designed to cover all aspects of your fitness journey.

  • Group Classes: Get motivated in a high-energy group setting. Classes include aerobics, cycling, kickboxing, Zumba, and TRX. These classes cater to various fitness levels and interests, making your workout fun and engaging.

  • Personal Training: Work one-on-one with a certified personal trainer to create a customized workout plan. Services include programming and body scans to help you track your progress and achieve specific goals. They also offer private lessons for more focused instruction.

  • Strength Training: Access a full range of equipment for strength training, including free weights and specialty equipment. Whether you're looking to build muscle or improve overall strength, you'll find what you need here.

  • Nutrition Consulting: Get expert guidance on your diet and nutrition. The gym provides nutrition consulting to complement your workout routine, helping you get the most out of your efforts.

  • Youth Classes: The gym also offers classes tailored for younger members, promoting a healthy and active lifestyle from an early age. This is a fantastic option for families in the area.

  • Supplement Store: Conveniently purchase a wide range of supplements to support your fitness goals. The onsite store offers products to help with everything from muscle recovery to energy levels.

  • Juice Shop: After your workout, refuel with a delicious and nutritious treat from the onsite juice shop. They serve up fresh smoothies and protein drinks to aid in recovery.


Features / Highlights

Beyond the core services, Smithfield Fitness offers a range of features that enhance the member experience.

  • Onsite and Outdoor Services: In addition to traditional gym workouts, the gym offers onsite services and outdoor services, giving you flexibility in how and where you train.

  • Online Classes: Can't make it to the gym? No problem. Smithfield Fitness provides online classes, allowing you to stay on track with your fitness goals from the comfort of your own home.

  • Comfort and Convenience: The facility is equipped with modern amenities to make your visit as comfortable as possible. You'll find clean restrooms and showers, as well as Wi-Fi to stay connected during your visit.

  • Payment Options: The gym accepts a variety of payment methods, including credit cards, debit cards, and NFC mobile payments, making transactions easy and secure.


Contact Information

To learn more or to get started on your fitness journey, you can reach out to Smithfield Fitness using the following contact information:

Address: 970 Douglas Pike, Smithfield, RI 02917, USA
Phone: (401) 618-5900

The gym operates with a membership required policy, which helps maintain a dedicated and consistent community of members. You can call or visit the location to inquire about membership options and find the plan that's right for you.


What is worth choosing

Choosing a gym is a personal decision, and Smithfield Fitness stands out for several compelling reasons. As a community-focused, family-owned business, it provides a warm and welcoming environment that larger, impersonal chains often lack. The gym prides itself on having a dedicated staff that is not only knowledgeable but also genuinely cares about the members' success. This personal touch can make a significant difference in your motivation and commitment to fitness.

The wide variety of services is another key benefit. From specialized training like kickboxing and TRX to personalized one-on-one sessions and nutrition consulting, the gym offers a holistic approach to wellness. The inclusion of a juice bar and supplement store means you have everything you need to fuel your body before and after your workout all in one place. Furthermore, the accessibility features, like the wheelchair-accessible entrance and restrooms, demonstrate a commitment to inclusivity, ensuring that the gym is a place where everyone can feel comfortable and confident pursuing their fitness goals.

The atmosphere at Smithfield Fitness is crafted to be inspiring and motivating, providing the perfect backdrop for your workouts. The combination of state-of-the-art equipment and a diverse range of classes ensures that you'll never get bored with your routine. Whether you prefer the structure of a group class, the intensity of a personal training session, or the flexibility of working out on your own, Smithfield Fitness provides the resources and support to help you succeed. It's more than a gym; it's a partner in your health journey, right here in the heart of Rhode Island.

Smithfield Fitness Services

  • Gym

  • Aerobics
  • Cycling
  • Kickboxing
  • Nutrition consulting

    Whether you want to burn fat, build muscle, or develop healthier eating habits, creating a nutrition plan should be all about meeting your specific goals.

  • Personal training

    Use one of our trainers as a personal coach as you begin a journey to get faster, stronger, and healthier. Training is suitable for everyone at any kind of fitness level. We have an excellent training program to get you the results you want.

  • Private lessons
  • Youth classes
  • Zumba
  • Group Classes

    Motivation Booster…Mixing the hottest music with cutting-edge exercises, motivation and the energy of many, challenges you to work out beyond your perceived limitations. Participating in group fitness classes make you fall in love with fitness. Discover our range of world-class group fitness classes

  • Personal Training
  • Strength Training
  • Supplement Store
  • TRX
  • Personal Trainer

  • Body Scan
  • Programing
  • Juice Shop

  • Smoothies
  • Protein Drinks

Smithfield Fitness Details

  • Service options

  • Online classes
  • Outdoor services
  • Onsite services
  • Accessibility

  • Wheelchair accessible entrance
  • Wheelchair accessible parking lot
  • Wheelchair accessible restroom
  • Amenities

  • Restroom
  • Wi-Fi
  • Wi-Fi
  • Atmosphere

  • Shower
  • Planning

  • Membership required
  • Payments

  • Credit cards
  • Debit cards
  • NFC mobile payments
  • Credit cards

Smithfield Fitness Photos

No photos available at the moment.

Smithfield Fitness Location

Smithfield Fitness

970 Douglas Pike, Smithfield, RI 02917, USA

Smithfield Fitness Reviews

An average rating of ★3.2 from 72 user reviews.

emailfeescallpaybankreviewschargesletterscaminformation

★ 5★ 4★ 3★ 2★ 1

More Fitness Near Me

  • R&F FitnessR&F Fitness4.0 (31 reviews)

    115 Sutton Ave, Oxford, MA 01540, USA

  • Better Life With YogaBetter Life With Yoga5.0 (35 reviews)

    351 Main St, Oxford, MA 01540, USA

  • Prime Fitness GymPrime Fitness Gym4.0 (128 reviews)

    1 Norwood Ct, North Oxford, MA 01537, USA

  • Hot Yoga AuburnHot Yoga Auburn5.0 (121 reviews)

    567 Southbridge St #6, Auburn, MA 01501, USA

  • Anytime FitnessAnytime Fitness4.0 (57 reviews)

    619 Southbridge St, Auburn, MA 01501, USA

  • Driven Performance Functional TrainingDriven Performance Functional Training5.0 (32 reviews)

    689 Southbridge St, Auburn, MA 01501, USA

  • Everybodys Fitness CenterEverybodys Fitness Center4.0 (77 reviews)

    441 Southbridge St, Auburn, MA 01501, USA

  • Hart Center at the Luth Athletic ComplexHart Center at the Luth Athletic Complex5.0 (25 reviews)

    Hart Center, 1 College St, Worcester, MA 01610, USA

  • Crossfit 1977Crossfit 19775.0 (36 reviews)

    299 Worcester Rd, Charlton, MA 01507, USA

  • F45 Training NorthboroughF45 Training Northborough5.0 (99 reviews)

    8114 Shops Way, Northborough, MA 01532, USA

  • Anytime FitnessAnytime Fitness4.0 (116 reviews)

    479 E Main St, Southbridge, MA 01550, USA

  • Planet FitnessPlanet Fitness4.0 (496 reviews)

    100 Boston Tpke, Shrewsbury, MA 01545, USA

  • Categories

    Top Visited Sites

    Must-Read Workout Wisdom Posts

    Top Fitness Searches

    Trending Workout Wisdom Posts