Hot Fitness
Hot FitnessWorkout WisdomFitness Near Me
ArizonaCaliforniaConnecticutDelawareDistrict of ColumbiaFloridaGeorgiaIllinoisIndianaIowaKansasKentuckyMaineMarylandMassachusettsMichiganMissouriNebraskaNevadaNew HampshireNew JerseyNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandTennesseeVermontVirginiaWashingtonWest VirginiaWisconsin

Hot FitnessFitness Near MeMissouriSt. Charles CountyWentzvilleFitness in Wentzville ParkwayDetox Yoga Wentzville
Detox Yoga Wentzville ico

Detox Yoga Wentzville
- 1155 Wentzville Pkwy #107-109, Wentzville, MO 63385

Yoga studio ★5.0

1155 Wentzville Pkwy #107-109, Wentzville, MO 63385, USA

5.0
Detox Yoga is amazing!! I have been a member since the start. April (the owner) has done an amazing job of adding in all different types of classes to meet everyone's needs. There are hot classes (103), warm classes (95), non heated (75-80), Ashtanga, Yin, and meditations. The environment is so welcoming to newbies and seasoned yogis!! The instructors are absolutely amazing and put their heart and soul into the classes. Totally do the $30 for 30 days of unlimited yoga special and try everything out and see what you like!! Hope to see you on your mat! I started here doing 1 class a week for recovery from weight lifting and now come 3-5 times a week!! - Nancy Johnson
Detox Yoga Wentzville Overview Intro Services Detail Photos Location Reviews

Detox Yoga Wentzville Introduce

Introduction / Overview

For residents across the St. Charles County region of Missouri seeking a dedicated space for self-care, movement, and mental clarity, the search often leads to

Detox Yoga Wentzville.

This highly-regarded local yoga studio is more than just a place to stretch; it's a community-focused sanctuary committed to supporting individuals on their unique wellness journeys. The studio’s core mission is to help people clear their mind, body, and soul, cultivating inner peace through a welcoming and accessible approach to the yogic path. With a variety of classes designed to cater to all levels—from absolute beginners to seasoned practitioners—Detox Yoga Wentzville ensures that everyone in the community can find a class that aligns with their personal comfort and fitness goals. The studio is well-known for offering both heated and non-heated classes, providing flexibility in intensity and style.

The encouraging and professional environment is a recurring theme noted by local members, who appreciate the owner's dedication to continuously adding different types of classes to meet varied needs. This focus on variety, coupled with instructors who are praised for putting their heart and soul into their teaching, creates an exceptionally supportive space. Whether you're looking for recovery from strenuous activity, seeking intense physical training, or simply desiring a mindful escape from daily life, Detox Yoga Wentzville stands out as a premier local destination for comprehensive well-being.

Location and Accessibility

Detox Yoga Wentzville is conveniently situated right in the heart of Wentzville, Missouri, making it easily accessible for local users from Wentzville and surrounding St. Charles County communities. The studio’s physical location at

1155 Wentzville Pkwy #107-109, Wentzville, MO 63385, USA,

places it in a high-visibility and convenient commercial area. This central positioning along the Wentzville Parkway ensures that your journey to the mat is straightforward and hassle-free, whether you're coming from home, work, or running errands.

A key aspect of the studio's commitment to the local community is its focus on accessibility. The facility has been designed to be welcoming to all, with the following accommodations in place:

  • Wheelchair accessible entrance
  • Wheelchair accessible parking lot
  • Wheelchair accessible restroom

These features demonstrate a dedication to ensuring that the benefits of yoga and movement are available to everyone in the Missouri region, regardless of mobility needs. While appointments are recommended to secure a spot in popular classes, the welcoming atmosphere is ready to embrace all who walk through the door. Additionally, local clients benefit from a multi-studio membership perk: membership often includes access to a sister location in Winghaven, providing flexibility and an even greater variety of scheduling options and amenities for users in the larger metropolitan area.

Services Offered

Detox Yoga Wentzville offers an extensive range of yoga and wellness services, going far beyond typical studio offerings to provide comprehensive options for all interests and experience levels. This diverse array is designed to support physical recovery, mental health, deep relaxation, and professional development.

  • Group Lessons (From $16.00): Standard classes offered on a regular schedule, including a mix of styles and temperatures.
  • Private Lessons (From $75.00): Personalized, one-on-one instruction tailored to individual goals, skill level, and schedule preferences.
  • Workshops: Specialized, in-depth sessions focusing on specific poses, techniques, or themes, offering a chance to deepen your practice.
  • Yoga Teacher Training (From $2,800.00): A comprehensive program for dedicated students looking to become certified yoga instructors and share the practice with others.
  • Aerial Yoga (From $25.00): A unique and fun class utilizing a soft fabric hammock suspended from the ceiling to support postures, deepen stretches, and allow for inversions.
  • Detox Hot Yoga: Classes held in a heated room (around 103°F) designed to promote intense sweating, detoxification, and muscle pliability.
  • Restorative Yoga: A deeply relaxing, non-heated style focusing on supported, long-held passive poses to promote physical and mental restoration.
  • Warm Vinyasa Yoga: A dynamic, flow-based practice held in a moderately heated room (around 95°F), combining the benefits of heat with continuous movement.
  • Power Vinyasa Yoga: A more physically demanding, faster-paced flow class designed to build strength, endurance, and cardiovascular health.

Features / Highlights

Detox Yoga Wentzville distinguishes itself from other local studios by emphasizing a unique combination of varied class temperatures, diverse styles, and practical conveniences, all aimed at enhancing the local user experience.

  • Temperature Variety: The studio offers a full spectrum of classes, from hot (approx. 103°F) and warm (approx. 95°F) options like Detox Hot Yoga and Warm Vinyasa, to non-heated classes (around 75-80°F) such as Restorative, Ashtanga, Yin, and Meditation, ensuring comfort for every preference.
  • Dual-Location Access: Members often have the significant benefit of being able to take classes at both the Wentzville and the Winghaven studio locations, providing maximum scheduling flexibility for those living or working across the St. Charles County area.
  • Specialty Wellness Offerings: While the Wentzville location is the primary focus, the Winghaven sister location features a wonderful Salt Room (Halotherapy), an amenity that members can access for additional healing and respiratory benefits at select times after class.
  • New Client Special: An exceptionally welcoming offer of 30 days of unlimited yoga for just $30 is available for new local customers. This allows prospective members to try out all the different classes and meet the amazing staff before committing to a membership.
  • Onsite Services and Amenities: The studio provides convenient onsite services and clean restroom amenities, ensuring a comfortable experience before and after class.
  • Flexible Payment Options: The studio accepts major Credit Cards and Debit Cards for easy and convenient payment processing.

Contact Information

Getting in touch with the local team at Detox Yoga Wentzville is easy and encouraged, especially for new clients interested in the 30-day trial or those with questions about teacher training.

  • Address: 1155 Wentzville Pkwy #107-109, Wentzville, MO 63385, USA
  • Phone: (636) 887-0222

What is Worth Choosing

For Missouri residents in the Wentzville and greater St. Charles area, choosing

Detox Yoga Wentzville

means investing in a locally rooted wellness institution defined by variety, professionalism, and a true sense of community. The studio’s commitment to providing a class for every need—whether it’s the intense rigor of Power Vinyasa, the deep surrender of Restorative Yoga, or the fun challenge of Aerial Yoga—is unparalleled. Many local users start with a single class a week for purposes like physical recovery and quickly find themselves integrating it into their daily routine due to the noticeable physical and mental benefits. The genuine dedication of the instructors, who are repeatedly cited for their passion and expertise, ensures high-quality instruction in every session.

The initial new customer special—$30 for 30 days of unlimited yoga—is arguably the single greatest reason to choose this studio, offering a risk-free way for local users to explore the full depth of their offerings, from hot to non-heated and everything in between. Furthermore, the practical convenience of the Wentzville Parkway location, the accessibility features, and the dual-location perk (including the unique salt room access at Winghaven) solidify Detox Yoga Wentzville as an optimal and worthwhile choice for anyone in the region committed to a healthier, happier lifestyle. It is a place where newbies are warmly welcomed, and seasoned yogis feel truly at home.

Alternative Option

If you're unable to visit Detox Yoga Wentzville in person, some readers choose to stay active at home instead. You may find home workout equipment available on Amazon helpful as an alternative.

Detox Yoga Wentzville Services

  • Yoga Studio

  • Group lessons From $16.00

    Come try a range of different group classes. We offer classes for all ages and levels of difficulty!! Check MINDBODY for our full schedule.

  • Private lessons From $75.00

    New too Yoga? NO PROBLEM!! Private Yoga classes will be customized to individuals needs. Private lessons are one hour.

  • Workshops

    At Detox, we offer a variety of workshops. These workshops range from learning philosophy of yoga all the way to standing on your head!!

  • Yoga Teacher Training From $2,800.00

    We offer a 200 Hour Yoga Teacher Training program certified under Yoga Alliance. this 200 Hour program is 10 months long and is taught by Anna Welsh and Amber Campbell.

  • Aerial Yoga From $25.00

    We offer small group aerial yoga classes. Come hang out with us!!

  • Detox Hot Yoga

    Detox is our featured sequence written by owner and operator of Detox, April Elliott. This sequence can be taken by beginner through advanced yogis. The sequence is done in a hot room and focuses on the breath and the movement along with a variety of flows, standing poses, and stretching.

  • Restorative Yoga

    When we face stressful situations, our nervous system prepares the body for battle: the sympathetic nervous system goes on alert, automatically recalibrating to increase blood pressure and heart rate and reduce digestion. Come learn how to slow down with us in a restorative nurturing deep stretch.

  • Warm Vinyasa Yoga

    This class is set in a warm room. Yogis will focus on linking conscious breath with a mindful flow. Students will build strength, flexibility, and concentration while cleansing and calming the mind, body, and soul. This practice finishes off with a rosemary and lavender infused cool towel. Rosemary

  • Power Vinyasa Yoga

    A heated class that gets moving quickly, flowing breath to movement building heat and strength for the full body. Finishes with a refreshing cool towel.

Detox Yoga Wentzville Details

  • Service options

  • Onsite services
  • Accessibility

  • Wheelchair accessible entrance
  • Wheelchair accessible parking lot
  • Wheelchair accessible restroom
  • Amenities

  • Restroom
  • Planning

  • Appointments recommended
  • Payments

  • Credit cards
  • Debit cards
  • Credit cards

Detox Yoga Wentzville Photos

Detox Yoga Wentzville Picture 1Detox Yoga Wentzville Picture 2Detox Yoga Wentzville Picture 3Detox Yoga Wentzville Picture 4Detox Yoga Wentzville Picture 5Detox Yoga Wentzville Picture 6Detox Yoga Wentzville Picture 7Detox Yoga Wentzville Picture 8Detox Yoga Wentzville Picture 9Detox Yoga Wentzville Picture 10

Detox Yoga Wentzville Location

Detox Yoga Wentzville

1155 Wentzville Pkwy #107-109, Wentzville, MO 63385, USA

Detox Yoga Wentzville Reviews

An average rating of ★5 from 105 user reviews.

feelclassesaprilpracticehot yogahappymeghanvinyasainvestwalk

★ 5★ 4★ 3★ 2★ 1

More Fitness Near Me

  • Elevate Yoga StudioElevate Yoga Studio0.0 (0 reviews)

    209 Main St, Hardin, IL 62047, USA

  • Planet FitnessPlanet Fitness4.0 (466 reviews)

    175 Flower Valley Shopping Center, Florissant, MO 63033, USA

  • Snap Fitness JerseyvilleSnap Fitness Jerseyville4.0 (32 reviews)

    1404 Windy Ln, Jerseyville, IL 62052, USA

  • JerseyFitJerseyFit5.0 (12 reviews)

    210 Vine St, Jerseyville, IL 62052, USA

  • Mid-Illinois Gymnastics and DanceMid-Illinois Gymnastics and Dance4.0 (14 reviews)

    1032 W Homer M Adams Pkwy, Godfrey, IL 62035, USA

  • Iron House CrossFitIron House CrossFit5.0 (24 reviews)

    2920 Greenwood Ln, Godfrey, IL 62035, USA

  • River Bend YogaRiver Bend Yoga4.0 (23 reviews)

    100 W 3rd St, Alton, IL 62002, USA

  • Radiance Yoga & WellnessRadiance Yoga & Wellness5.0 (6 reviews)

    211 E Broadway, Alton, IL 62002, USA

  • Nautilus Fitness CenterNautilus Fitness Center4.0 (169 reviews)

    4425 Industrial Dr, Alton, IL 62002, USA

  • Functional Fitness ImagesFunctional Fitness Images5.0 (16 reviews)

    2712 Corner Ct, Alton, IL 62002, USA

  • Planet FitnessPlanet Fitness4.0 (256 reviews)

    3000 Homer M Adams Pkwy, Alton, IL 62002, USA

  • Club Fitness - EastgateClub Fitness - Eastgate4.0 (572 reviews)

    47 Eastgate Plaza, East Alton, IL 62024, USA

  • Categories

    Top Visited Sites

    Must-Read Workout Wisdom Posts

    Top Fitness Searches

    Trending Workout Wisdom Posts