Detox Yoga Wentzville Introduce
Introduction / Overview
For residents across the St. Charles County region of Missouri seeking a dedicated space for self-care, movement, and mental clarity, the search often leads to
Detox Yoga Wentzville.
This highly-regarded local yoga studio is more than just a place to stretch; it's a community-focused sanctuary committed to supporting individuals on their unique wellness journeys. The studio’s core mission is to help people clear their mind, body, and soul, cultivating inner peace through a welcoming and accessible approach to the yogic path. With a variety of classes designed to cater to all levels—from absolute beginners to seasoned practitioners—Detox Yoga Wentzville ensures that everyone in the community can find a class that aligns with their personal comfort and fitness goals. The studio is well-known for offering both heated and non-heated classes, providing flexibility in intensity and style.The encouraging and professional environment is a recurring theme noted by local members, who appreciate the owner's dedication to continuously adding different types of classes to meet varied needs. This focus on variety, coupled with instructors who are praised for putting their heart and soul into their teaching, creates an exceptionally supportive space. Whether you're looking for recovery from strenuous activity, seeking intense physical training, or simply desiring a mindful escape from daily life, Detox Yoga Wentzville stands out as a premier local destination for comprehensive well-being.
Location and Accessibility
Detox Yoga Wentzville is conveniently situated right in the heart of Wentzville, Missouri, making it easily accessible for local users from Wentzville and surrounding St. Charles County communities. The studio’s physical location at
1155 Wentzville Pkwy #107-109, Wentzville, MO 63385, USA,
places it in a high-visibility and convenient commercial area. This central positioning along the Wentzville Parkway ensures that your journey to the mat is straightforward and hassle-free, whether you're coming from home, work, or running errands.A key aspect of the studio's commitment to the local community is its focus on accessibility. The facility has been designed to be welcoming to all, with the following accommodations in place:
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
- Wheelchair accessible restroom
These features demonstrate a dedication to ensuring that the benefits of yoga and movement are available to everyone in the Missouri region, regardless of mobility needs. While appointments are recommended to secure a spot in popular classes, the welcoming atmosphere is ready to embrace all who walk through the door. Additionally, local clients benefit from a multi-studio membership perk: membership often includes access to a sister location in Winghaven, providing flexibility and an even greater variety of scheduling options and amenities for users in the larger metropolitan area.
Services Offered
Detox Yoga Wentzville offers an extensive range of yoga and wellness services, going far beyond typical studio offerings to provide comprehensive options for all interests and experience levels. This diverse array is designed to support physical recovery, mental health, deep relaxation, and professional development.
- Group Lessons (From $16.00): Standard classes offered on a regular schedule, including a mix of styles and temperatures.
- Private Lessons (From $75.00): Personalized, one-on-one instruction tailored to individual goals, skill level, and schedule preferences.
- Workshops: Specialized, in-depth sessions focusing on specific poses, techniques, or themes, offering a chance to deepen your practice.
- Yoga Teacher Training (From $2,800.00): A comprehensive program for dedicated students looking to become certified yoga instructors and share the practice with others.
- Aerial Yoga (From $25.00): A unique and fun class utilizing a soft fabric hammock suspended from the ceiling to support postures, deepen stretches, and allow for inversions.
- Detox Hot Yoga: Classes held in a heated room (around 103°F) designed to promote intense sweating, detoxification, and muscle pliability.
- Restorative Yoga: A deeply relaxing, non-heated style focusing on supported, long-held passive poses to promote physical and mental restoration.
- Warm Vinyasa Yoga: A dynamic, flow-based practice held in a moderately heated room (around 95°F), combining the benefits of heat with continuous movement.
- Power Vinyasa Yoga: A more physically demanding, faster-paced flow class designed to build strength, endurance, and cardiovascular health.
Features / Highlights
Detox Yoga Wentzville distinguishes itself from other local studios by emphasizing a unique combination of varied class temperatures, diverse styles, and practical conveniences, all aimed at enhancing the local user experience.
- Temperature Variety: The studio offers a full spectrum of classes, from hot (approx. 103°F) and warm (approx. 95°F) options like Detox Hot Yoga and Warm Vinyasa, to non-heated classes (around 75-80°F) such as Restorative, Ashtanga, Yin, and Meditation, ensuring comfort for every preference.
- Dual-Location Access: Members often have the significant benefit of being able to take classes at both the Wentzville and the Winghaven studio locations, providing maximum scheduling flexibility for those living or working across the St. Charles County area.
- Specialty Wellness Offerings: While the Wentzville location is the primary focus, the Winghaven sister location features a wonderful Salt Room (Halotherapy), an amenity that members can access for additional healing and respiratory benefits at select times after class.
- New Client Special: An exceptionally welcoming offer of 30 days of unlimited yoga for just $30 is available for new local customers. This allows prospective members to try out all the different classes and meet the amazing staff before committing to a membership.
- Onsite Services and Amenities: The studio provides convenient onsite services and clean restroom amenities, ensuring a comfortable experience before and after class.
- Flexible Payment Options: The studio accepts major Credit Cards and Debit Cards for easy and convenient payment processing.
Contact Information
Getting in touch with the local team at Detox Yoga Wentzville is easy and encouraged, especially for new clients interested in the 30-day trial or those with questions about teacher training.
- Address: 1155 Wentzville Pkwy #107-109, Wentzville, MO 63385, USA
- Phone: (636) 887-0222
What is Worth Choosing
For Missouri residents in the Wentzville and greater St. Charles area, choosing
Detox Yoga Wentzville
means investing in a locally rooted wellness institution defined by variety, professionalism, and a true sense of community. The studio’s commitment to providing a class for every need—whether it’s the intense rigor of Power Vinyasa, the deep surrender of Restorative Yoga, or the fun challenge of Aerial Yoga—is unparalleled. Many local users start with a single class a week for purposes like physical recovery and quickly find themselves integrating it into their daily routine due to the noticeable physical and mental benefits. The genuine dedication of the instructors, who are repeatedly cited for their passion and expertise, ensures high-quality instruction in every session.The initial new customer special—$30 for 30 days of unlimited yoga—is arguably the single greatest reason to choose this studio, offering a risk-free way for local users to explore the full depth of their offerings, from hot to non-heated and everything in between. Furthermore, the practical convenience of the Wentzville Parkway location, the accessibility features, and the dual-location perk (including the unique salt room access at Winghaven) solidify Detox Yoga Wentzville as an optimal and worthwhile choice for anyone in the region committed to a healthier, happier lifestyle. It is a place where newbies are warmly welcomed, and seasoned yogis feel truly at home.
Alternative Option
Detox Yoga Wentzville Services
Yoga Studio
- Group lessons From $16.00
Come try a range of different group classes. We offer classes for all ages and levels of difficulty!! Check MINDBODY for our full schedule.
- Private lessons From $75.00
New too Yoga? NO PROBLEM!! Private Yoga classes will be customized to individuals needs. Private lessons are one hour.
- Workshops
At Detox, we offer a variety of workshops. These workshops range from learning philosophy of yoga all the way to standing on your head!!
- Yoga Teacher Training From $2,800.00
We offer a 200 Hour Yoga Teacher Training program certified under Yoga Alliance. this 200 Hour program is 10 months long and is taught by Anna Welsh and Amber Campbell.
- Aerial Yoga From $25.00
We offer small group aerial yoga classes. Come hang out with us!!
- Detox Hot Yoga
Detox is our featured sequence written by owner and operator of Detox, April Elliott. This sequence can be taken by beginner through advanced yogis. The sequence is done in a hot room and focuses on the breath and the movement along with a variety of flows, standing poses, and stretching.
- Restorative Yoga
When we face stressful situations, our nervous system prepares the body for battle: the sympathetic nervous system goes on alert, automatically recalibrating to increase blood pressure and heart rate and reduce digestion. Come learn how to slow down with us in a restorative nurturing deep stretch.
- Warm Vinyasa Yoga
This class is set in a warm room. Yogis will focus on linking conscious breath with a mindful flow. Students will build strength, flexibility, and concentration while cleansing and calming the mind, body, and soul. This practice finishes off with a rosemary and lavender infused cool towel. Rosemary
- Power Vinyasa Yoga
A heated class that gets moving quickly, flowing breath to movement building heat and strength for the full body. Finishes with a refreshing cool towel.
Detox Yoga Wentzville Details
Service options
- Onsite services
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
- Wheelchair accessible restroom
Amenities
- Restroom
Planning
- Appointments recommended
Payments
- Credit cards
- Debit cards
- Credit cards
Detox Yoga Wentzville Photos










Detox Yoga Wentzville Location
Detox Yoga Wentzville
1155 Wentzville Pkwy #107-109, Wentzville, MO 63385, USA
Detox Yoga Wentzville Reviews
feelclassesaprilpracticehot yogahappymeghanvinyasainvestwalk
★ 5★ 4★ 3★ 2★ 1Detox Yoga is amazing!! I have been a member since the start. April (the owner) has done an amazing job of adding in all different types of classes to meet everyone's needs. There are hot classes (103), warm classes (95), non heated (75-80), Ashtanga, Yin, and meditations. The environment is so welcoming to newbies and seasoned yogis!! The instructors are absolutely amazing and put their heart and soul into the classes. Totally do the $30 for 30 days of unlimited yoga special and try everything out and see what you like!! Hope to see you on your mat! I started here doing 1 class a week for recovery from weight lifting and now come 3-5 times a week!!
April 23 · Nancy JohnsonI love that we have both a Wentzville and Winghaven location and that we are able to take classes at Both! There are classes for all levels of fitness here and they even have a wonderful salt room at the Winghaven location which has many great benefits to sign up for at select times after you're done w class. If you have never been here I encourage you to take advantage of the new customer special of 30 days for $30 and try all the different classes and meet all the instructors during that time and find out what your favorites are
April 25 · Heather LaneDetox is a supportive community with amazing teachers who help guide you through your yoga practice while challenging you but acknowledging your own individuality. Highly recommend either studio and each and every teacher!!
April 24 · Stacey HennessyThis place is absolutely amazing. The instructors are knowledgeable, friendly, and genuine. They each bring their own expertise and unique experiences into the classes.
August 27 · Mom LoveYoga offers so much for everyone. There is a different variety of classes and times and two locations. The instructors are all awesome and very helpful.
April 29 · Janet Trail
More Fitness Near Me
Elevate Yoga Studio0.0 (0 reviews)209 Main St, Hardin, IL 62047, USA
Planet Fitness4.0 (466 reviews)175 Flower Valley Shopping Center, Florissant, MO 63033, USA
Snap Fitness Jerseyville4.0 (32 reviews)1404 Windy Ln, Jerseyville, IL 62052, USA
JerseyFit5.0 (12 reviews)210 Vine St, Jerseyville, IL 62052, USA
Mid-Illinois Gymnastics and Dance4.0 (14 reviews)1032 W Homer M Adams Pkwy, Godfrey, IL 62035, USA
Iron House CrossFit5.0 (24 reviews)2920 Greenwood Ln, Godfrey, IL 62035, USA
River Bend Yoga4.0 (23 reviews)100 W 3rd St, Alton, IL 62002, USA
Radiance Yoga & Wellness5.0 (6 reviews)211 E Broadway, Alton, IL 62002, USA
Nautilus Fitness Center4.0 (169 reviews)4425 Industrial Dr, Alton, IL 62002, USA
Functional Fitness Images5.0 (16 reviews)2712 Corner Ct, Alton, IL 62002, USA
Planet Fitness4.0 (256 reviews)3000 Homer M Adams Pkwy, Alton, IL 62002, USA
Club Fitness - Eastgate4.0 (572 reviews)47 Eastgate Plaza, East Alton, IL 62024, USA
Categories
Top Visited Sites
Oasis Nutrition4.0 (15 reviews)
Pilates En Pointe5.0 (33 reviews)
The Pilates Barre5.0 (67 reviews)
Player's Fitness and Performance Eldersburg5.0 (148 reviews)
Onelovewellness5.0 (3 reviews)
West Philadelphia YMCA4.0 (927 reviews)Must-Read Workout Wisdom Posts
Top Fitness Searches
Trending Workout Wisdom Posts
How to Do Home Workout Safely and Effectively
Best Foods to Eat Before and After Home Workout
How to Use Mobility Tests to Personalize Your Fall Strength and Running Program
How to Use Short Strength Sessions to Maintain Muscle During High Mileage Weeks
Strength Training for Runners: Two Weekly Lifts to Boost Speed and Durability
The Best Practices for Tracking Training Stress and Avoiding Burnout During Heavy Autumn Training
